Protein Info for Shew_0117 in Shewanella loihica PV-4

Annotation: protoheme IX farnesyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 53 to 74 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 18 to 296 (279 residues), 321 bits, see alignment E=4.4e-100 PF01040: UbiA" amino acids 33 to 280 (248 residues), 231.6 bits, see alignment E=4.6e-73

Best Hits

Swiss-Prot: 100% identical to CYOE1_SHELP: Protoheme IX farnesyltransferase 1 (cyoE1) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to slo:Shew_0117)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q941 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Shew_0117 protoheme IX farnesyltransferase (RefSeq) (Shewanella loihica PV-4)
MAKPMTITKPVATPLPWRAYLEMTKPRVVALMLLTVLVGMCLAVPGAVPVQPLIAGLVGI
GMMAGAAAAYNHLIDRRIDGLMARTYNRPLPKGRISITKALTFATAMAILGFALLYWAVN
PLTAWLTFASLIGYAVIYTAYLKRATPQNIVVGGLAGAMPPLLGWTAITGEFHGHALLLV
IIIFAWTPPHFWALAIHRRAEYAKVDVPMLPVTHGVEFTKTCIMLYTVLLALACLYPVLV
GMCGPLYLVGSTLLSCGFIYKAWQLKYRDKPGLAMQVFRFSIYHLMLLFLLLLVDHYLWS