Protein Info for Shew_0111 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 864 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details PF13188: PAS_8" amino acids 240 to 291 (52 residues), 18.1 bits, see alignment 5.9e-07 amino acids 369 to 421 (53 residues), 25.4 bits, see alignment 3.1e-09 PF08448: PAS_4" amino acids 375 to 486 (112 residues), 23.9 bits, see alignment E=1.3e-08 PF00015: MCPsignal" amino acids 641 to 797 (157 residues), 192.5 bits, see alignment E=1.7e-60

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to slo:Shew_0111)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q935 at UniProt or InterPro

Protein Sequence (864 amino acids)

>Shew_0111 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Shewanella loihica PV-4)
MDAMNSKTGNANNLPIIGLLIAGVAALLAFTQQPSLWVGIAQVVAIAVIALGIQQQGQTQ
HSLRQAFEEIHQALEGKNPPSFSAFDYPHWPEISQSLTQQWHANQGNQAQLRALEICQAN
VMLADPQGNINFLNQSLRQTLEKAESDIQQAIASFSVDTLIGTNMDTFHQQPSHQQNIIA
KLQRPHSAQIKVGSRIFSLIASPVFDDKHQRIATVVEWQDKTEALAKADAENKLAQENSR
IKQALDVCRANVMVADADYNIIYLNDSVTQMLKDNEQTLQQTLTKFNTNSLLGSNIDIFH
QNPAHQRKMLDRLTGSYDTSIQVAGLDFTLIATPVFENGVRTGTVVEWQDVTEKLAKEAK
ERQLAAENARIKQALDNVSSNTMVADADLNIIYMNKAVSQMFKQAQNDIAKDLPNFDASN
LMGVNIDNFHKNPSHQRNLLKTLTTTYTSQLKVGGRTFQVVANPIRDPNGESIGTVVEWA
DRTAEVAIEHEIDSIIGAASKGDLSLRVGTQDKEGFFLNLSNGLNRLVGIADQVIGDVVN
MFDGLAKGDLNRQIQGEYQGQFGKLQADANATAAKLTEVLDGINQSANTVTSGAEEIAQG
NADLSQRTEEQAASLEETASSMEEMTATVTQSAQNATVANQLAQEANTKAAHGGKVVEQA
VTAMEAINESSKRIADIIGVIDEIAFQTNLLALNAAVEAARAGEQGRGFAVVAGEVRNLA
QRSAGAAKEIKELIRDSVTKVTDGTQLVNQSGETLEDIVQAVTKVADMISQISIASDQQS
AGIQEVNKAISQMDEMTQQNAALVEQVSAAGDAMAEQARNMKSQLGFFQSQAPMHSGMTS
APLSLVAGDSHGPLNISNEEWNEF