Protein Info for Shew_0098 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 130 to 152 (23 residues), see Phobius details PF00672: HAMP" amino acids 151 to 203 (53 residues), 37.2 bits, see alignment 4.5e-13 PF00512: HisKA" amino acids 213 to 272 (60 residues), 35.3 bits, see alignment E=1.5e-12 PF02518: HATPase_c" amino acids 317 to 417 (101 residues), 76 bits, see alignment E=4.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0098)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q922 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Shew_0098 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MTLIIGTLLFGMYRQLINEQELQTNQHLAAEKLRYQQMALTLDRRSFATQIRTADPKTAL
VVWRSSLDLVGALSLMPDDMPLLPETRDFPILTSGPDKLHILTGGLVITRYGPVLIATRT
DQLATLIERFVNAAITALMLTIVLTLALGYLFSKAILRRLVQYNRLSRRIERGEYSTRLP
VSWRQDEFDMLAGNFNQVLDTLEANLHAVRGATDNIAHDLRTPLSHLRIGLEQLPQRPAE
ELDEASAILIEELDHCLATFDAMLSLTRIEEGQQDLELQPLSLNDLCQDLFEMAEAMAES
NGQTLSLSLDQDYSVMGDKYLLFQALFNLVDNAIKYSGEGAKIEIIQQGNEILIRDNGPG
IPDDATEKVFDRLVRLDPSRHNKGTGLGLSLVKAILQRHNARIELSDNQPGLQVSIRFS