Protein Info for Shew_0060 in Shewanella loihica PV-4

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF13247: Fer4_11" amino acids 54 to 125 (72 residues), 36.6 bits, see alignment E=1.5e-12 PF12797: Fer4_2" amino acids 83 to 101 (19 residues), 27.7 bits, see alignment (E = 6e-10) PF12837: Fer4_6" amino acids 84 to 104 (21 residues), 28.5 bits, see alignment (E = 3.8e-10) PF00037: Fer4" amino acids 85 to 104 (20 residues), 30.4 bits, see alignment (E = 8.6e-11) PF12838: Fer4_7" amino acids 88 to 161 (74 residues), 33.2 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 64% identical to FDHB_WOLSU: Formate dehydrogenase iron-sulfur subunit (fdhB1) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to slo:Shew_0060)

Predicted SEED Role

"Formate dehydrogenase-O, iron-sulfur subunit (EC 1.2.1.2); Putative formate dehydrogenase iron-sulfur subunit (EC 1.2.1.2)" (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8Y5 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Shew_0060 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MAVMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTINDGQPGEASISVACMHC
TDAPCQAVCPANCFYKTEDGLTLHNKDTCIGCGYCLYACPFGAPQFPKKSTFGSRGKMDK
CTFCAGGPEETFSEAERKKYGANRLAEGKLPMCAELCSTKALLAGDAEVVSNIYRERIAA
RGNPNAIWGYTPKTGV