Protein Info for Shew_0046 in Shewanella loihica PV-4

Annotation: molybdenum cofactor synthesis domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF03453: MoeA_N" amino acids 16 to 174 (159 residues), 156.5 bits, see alignment E=7.2e-50 TIGR00177: molybdenum cofactor synthesis domain" amino acids 185 to 318 (134 residues), 106.9 bits, see alignment E=4.5e-35 PF00994: MoCF_biosynth" amino acids 198 to 323 (126 residues), 114.3 bits, see alignment E=5.9e-37 PF03454: MoeA_C" amino acids 337 to 409 (73 residues), 59.8 bits, see alignment E=3.8e-20

Best Hits

Swiss-Prot: 50% identical to MOEA_SALTY: Molybdopterin molybdenumtransferase (moeA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to slo:Shew_0046)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8X1 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_0046 molybdenum cofactor synthesis domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSMQADPCAKPSLMHPDEAIIKLLEQVRPLEESEMVQLPHALGRVLAEDLASSIDLPPFD
NSAMDGYAFRFEDLAQGNRFTLIGHSFAGHPFEGEASANTCVRIMTGAPVPPGYDTVQMQ
EKVEVDGDSIVIEAPKALGANVRRRGEEVMTGGKVLCAGTQIGAAEMGVLATIGASQVRV
TRLVKVAFFSTGDELRPVGTELAPGQIYDSNRYSIQGLLSRANVEWIDLGVIEDDPEAIR
AAFRNAAANADMVLTSGGVSVGDADFTKQILDEEGEITFWKLAIKPGKPFAFGRIGEAVF
CGLPGNPVSSMVTFYKLVWPLLNKMQGLPQVKPLQLQAKLKGNLRKFPGRVEYQRGVLSQ
NAQGEAEVSVTGGQGSGMLTSMSLANCFIILAQEQGDTPDGSLVTVEPFNSVLAL