Protein Info for Shew_0036 in Shewanella loihica PV-4

Annotation: phosphoesterase, PA-phosphatase related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details PF01569: PAP2" amino acids 93 to 202 (110 residues), 83.4 bits, see alignment E=6.2e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0036)

Predicted SEED Role

"FIG01286086: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8W1 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Shew_0036 phosphoesterase, PA-phosphatase related (RefSeq) (Shewanella loihica PV-4)
MFRLTQAQTTRETALTMTTDRSRYGTLILLVSMLALLCLNQDLNLSLFRAINGLSPSLPQ
WLQLGITDLGHGSTLGTIVLICLLRRPELMPRVLTASLLSMILVPLLKQYFDAPRPAATL
DFLYIVGETRLHHSFPSGHSTSAFLFAGSLLMVMQDKKSKWVLLMGAAMVALSRILVGAH
WPVDTLAGALLGLSCAYVASYVPLVHLSPRHWKILMGILLLTLLVCQYKETSSQMAWQII
GLRWGLLLLAGVLVLRQYLQSRQPLTPRKWVRA