Protein Info for Shew_0001 in Shewanella loihica PV-4

Name: dnaA
Annotation: chromosomal replication initiation protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 71.4 bits, see alignment E=1.3e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 457 (452 residues), 622.3 bits, see alignment E=2.6e-191 PF00308: Bac_DnaA" amino acids 125 to 284 (160 residues), 243 bits, see alignment E=5.2e-76 PF01695: IstB_IS21" amino acids 160 to 262 (103 residues), 28 bits, see alignment E=4.8e-10 PF00004: AAA" amino acids 161 to 268 (108 residues), 28.3 bits, see alignment E=6.5e-10 PF22688: Hda_lid" amino acids 293 to 355 (63 residues), 34.4 bits, see alignment E=5.4e-12 PF08299: Bac_DnaA_C" amino acids 368 to 436 (69 residues), 110.9 bits, see alignment E=7.2e-36

Best Hits

Swiss-Prot: 100% identical to DNAA_SHELP: Chromosomal replication initiator protein DnaA (dnaA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to slo:Shew_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q8S6 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Shew_0001 chromosomal replication initiation protein (RefSeq) (Shewanella loihica PV-4)
MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGETLVLYAPNRFVLDWVRDKYLNTIN
QFFTEQMGSDAPKLRFDIGSRPASKPAAPAASTKSPVAPAAKSPSKPSFNSNEPAATANH
RSNMNPTYQFDNFVEGKSNQLGKAAALQVSENPGGAYNPLFLYGGTGLGKTHLLHAVGNG
IIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALFIDDIQFFANKDRSQE
EFFHTFNALLEGNHQVILTSDRYPKEIDGVEDRLKSRFGWGLTVAIEPPELETRVAILMR
KAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLA
LQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVARPRQMAMALSKELTNQSLPEIGDA
FGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRTLSS