Protein Info for DVUA0118 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: type III secretion protein, YopL family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR02499: type III secretion apparatus protein, HrpE/YscL family" amino acids 19 to 188 (170 residues), 160.9 bits, see alignment E=1.5e-51 PF06635: T3SS_SCTL" amino acids 20 to 200 (181 residues), 39.3 bits, see alignment E=5.3e-14 PF02108: FliH" amino acids 74 to 195 (122 residues), 48.6 bits, see alignment E=7.7e-17

Best Hits

Swiss-Prot: 32% identical to YSCL_YEREN: Yop proteins translocation protein L (yscL) from Yersinia enterocolitica

KEGG orthology group: K03223, type III secretion protein SctL (inferred from 100% identity to dvl:Dvul_2989)

Predicted SEED Role

"Type III secretion cytoplasmic protein (YscL)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WH1 at UniProt or InterPro

Protein Sequence (205 amino acids)

>DVUA0118 type III secretion protein, YopL family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGALFRLNASTVVPAAGRRVLRAADAALLCEAQDILAAARERAAALEREAEEAYARRLDE
GYNDGLEQGRMEHAEKVLETVLSSVEFIEGIEGTVVRVVTESIRKVIGEMDDDERIVRIV
RNALVAVRNQQRVTIRVAPADEKAVTESLAAMLQRAPGSVGFLDVVADPRLARGACLLES
ELGVVDASLETQLAALEKAFHAKIR