Protein Info for DVU3257 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: DNA internalization-related competence protein ComEC/Rec2 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 974 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 372 to 387 (16 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 415 to 432 (18 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details amino acids 517 to 539 (23 residues), see Phobius details amino acids 549 to 570 (22 residues), see Phobius details amino acids 579 to 598 (20 residues), see Phobius details amino acids 618 to 638 (21 residues), see Phobius details amino acids 678 to 696 (19 residues), see Phobius details PF03772: Competence" amino acids 310 to 631 (322 residues), 150.8 bits, see alignment E=7.5e-48 TIGR00360: ComEC/Rec2-related protein" amino acids 333 to 460 (128 residues), 44.9 bits, see alignment E=1.5e-15 PF00753: Lactamase_B" amino acids 708 to 910 (203 residues), 28.2 bits, see alignment E=2.7e-10

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to dvu:DVU3257)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q726D4 at UniProt or InterPro

Protein Sequence (974 amino acids)

>DVU3257 DNA internalization-related competence protein ComEC/Rec2 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNLARTPSLLFRQVCMLAWVGGLFAARHPLPALCAFALLLAGDWPRARVPARFVLLCLCY
AAGWGVALAALPETPPTPAWVTGKPQRVTGIVDDVDGLPDGRLRIMLRDVHPVFPEGGAS
PVVTAGDEGDGSEAEGLPVDVAEGEDRADSRPARPTVAENAAGRGEGAGQPETARAGSHL
PPEVRAMGGETGRGVQPAPLVPPAPPLPGRLVWTWEHPVALPLTGQTVTATLAVKPVRGF
ANPGGQDSAAYWQRRDAHFRAWARDDMPRAEVTGAPSGPAALRAWLRERLVDTLGGPQGI
TRGGGVLLAILFGDRFHLDSAMLDLFARTDLLHSLALSGQHLAVAGLFAGAAVLLVGRFT
PGVFLRLPRRKLLFVLSLPPAAAYLWLGNAPPSLVRAALMLLFWTVLALADRPGVLLDGL
LWAVGCILLFDPDAVYDLGLQLSALAVASIALSLPFAAWLHGGGHHGNFRPGTAPPLAGV
TGSTGTLSTGTEGISDAGGPDTATLRDGVWQRVRRTLMLMALTTLAVQVALLPVQLIGFG
RASPWFALNLLWLPFADLVVLPLGALGLVCEAADLTRPLAGPLLMVAALPCEGLMWLLEW
MEGAGLLAVPAMLRPHWTAALGYGALVVAFASLPGRLFHFPARGRASHHAPHGATPAGTL
LAGARAAAPCLPPLARRLLPFALALLLAGPVLRLYAATDGTVRVSVLDVGQGQAIAIDLP
GDRRLLVDGGGFNSPRFDAGRDLVAPALTANRSPRLDMVLNTHPDTDHLRGLIHILDRFA
VDAFATNGDAPRGLNARDLSRVLARTGMEATPMYAGEVLPLGDGLALRVLHPPQKHRGSS
NNKALVLRLERDGRGLAVLCGDAEAPALRDILRSGAPLKAEVLVLPHHGSASSLLPAFYD
AVAPRLAIASCGVDNRYGFPVAAVRAALAERGVTLRTTGEAGCIMLGWDDGGRGPLTLDT
SRDRGAADTSAFGE