Protein Info for DVU1918 in Desulfovibrio vulgaris Hildenborough JW710

Name: hysA
Annotation: periplasmic [NiFeSe] hydrogenase, large subunit, selenocysteine-containing (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF27537: HoxH" amino acids 18 to 47 (30 residues), 33.4 bits, see alignment (E = 3.9e-12) PF00374: NiFeSe_Hases" amino acids 53 to 132 (80 residues), 120.2 bits, see alignment E=1.3e-38 amino acids 135 to 495 (361 residues), 305.2 bits, see alignment E=1e-94

Best Hits

Swiss-Prot: 65% identical to PHSL_DESBA: Periplasmic [NiFeSe] hydrogenase large subunit from Desulfomicrobium baculatum

KEGG orthology group: K00532, ferredoxin hydrogenase [EC: 1.12.7.2] (inferred from 100% identity to dvu:DVU1918)

MetaCyc: 100% identical to cytochrome-c3 [NiFe]-hydrogenase large subunit (Desulfovibrio vulgaris)
Cytochrome-c3 hydrogenase. [EC: 1.12.2.1]

Predicted SEED Role

"[Ni/Fe] hydrogenase, group 1, large subunit; selenocysteine-containing"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.2.1 or 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AS3 at UniProt or InterPro

Protein Sequence (510 amino acids)

>DVU1918 periplasmic [NiFeSe] hydrogenase, large subunit, selenocysteine-containing (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSGCTPKAAPAGATGRTTIAIDPVTRIEGHLKAEVVVENGKVVDARLSGGMYRGFETILR
GRDPRDASQIVQRICGVCPTAHSTASVLALDEAFGAKVPNNGRITRNLIFGANYLQSHIL
HFYHLSAQDFVQGPDTAPFVPRFPKSDLRLSKELNKAGVDQYIEALEVRRICHEMVALFG
GRMPHVQGQVVGGATEIPTKEKLVEYAARFKKVRDFVEQKYVPVVYTIGSKYKDMFKVGQ
GFKAALCVGAFPLDNSGKKHLFMPGVYAKGKDMPFDPSKIKEYVKYSWFAEETTGLNYKE
GKTIPAPDKAGAYSFVKAPRYDGLSLEVGPLARMWVNNPELSPVGKKLLKDLFGISAKKF
RDLGEEAAFSLMGRHVARAEETYYMLGAIEGWLKEIKAGEDTVVMPAVPASAEGTGFTEA
PRGSLLHYVKVKDSKIDNYQIVSASLWNCNPRDDMGQRGAVEEALIGIPVDDIQNPVNVA
RLIRAFDPULGCAVHVLHAESGKVAVIEVK