Protein Info for DVU1290 in Desulfovibrio vulgaris Hildenborough JW710

Name: DsrM
Annotation: Inner membrane protein binds 2 heme b (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details PF02665: Nitrate_red_gam" amino acids 117 to 273 (157 residues), 54.2 bits, see alignment E=7.7e-19

Best Hits

Swiss-Prot: 48% identical to HMEC_ARCFU: Hdr-like menaquinol oxidoreductase cytochrome b-like subunit (hmeC) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K00374, nitrate reductase 1, gamma subunit [EC: 1.7.99.4] (inferred from 100% identity to dvl:Dvul_1775)

MetaCyc: 100% identical to DsrM (Desulfovibrio vulgaris Hildenborough)
1.8.5.h [EC: 1.8.5.h]

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP protein DsrM (= HmeC)" in subsystem Sulfate reduction-associated complexes

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.99.4 or 1.8.5.h

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CJ3 at UniProt or InterPro

Protein Sequence (334 amino acids)

>DVU1290 Inner membrane protein binds 2 heme b (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MFFSFLAVIALACIAWLGAVSGFQYVLGVVLPLAAMLVFIVGFVWRIVDWAKSPVPFRIP
TTGGQQRSLDWIKPARLDSPYTTTGTVGRMLLEVLLFRSLFRNTSMEIQNGPRVVYYSAK
WLWLFALIFHYCFLTIFIRHFRFFLEPVPFAISFMETLDGIMQIGAPRMFMTDVLVVVAL
VFLLCRRLFSEKIRYISLANDYFPLFLILGLVGSGIWMRYFAKVDIASVKVLTMGLVTLN
PVVPDGIGTVFFIHMMFLSALLMYFPFSKLMHMGGVFLSPTRNLPNNSRAVRHVNPWNPP
KKYRTYAEYEDEFRDLMAEAGLPLDKKPDEAAAE