Protein Info for DVU0833 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein TIGR00252 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR00252: TIGR00252 family protein" amino acids 6 to 118 (113 residues), 80.8 bits, see alignment E=4e-27 PF08378: NERD" amino acids 9 to 58 (50 residues), 22.6 bits, see alignment E=1.3e-08 PF02021: UPF0102" amino acids 12 to 102 (91 residues), 90.6 bits, see alignment E=6.7e-30

Best Hits

Swiss-Prot: 100% identical to Y2148_DESVV: UPF0102 protein Dvul_2148 (Dvul_2148) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K07460, putative endonuclease (inferred from 100% identity to dvu:DVU0833)

Predicted SEED Role

"Endonuclease (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DU6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>DVU0833 conserved hypothetical protein TIGR00252 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVDARHATGQHGEDEAAALLQRTGHRIIARNWRHGGLELDIICETGDTIVFVEVKTRAAH
GLTSPTDALTHQKRHRLIRAARAWLAAADAWDRACRFDLVCVTQRGATCTLEHITDAFDL
TETLGGGDTSWQPW