Protein Info for DVU0251 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 197 to 224 (28 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details PF01925: TauE" amino acids 7 to 306 (300 residues), 97.3 bits, see alignment E=5.6e-32

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dvl:Dvul_2726)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FG3 at UniProt or InterPro

Protein Sequence (320 amino acids)

>DVU0251 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSPVLSFLWAIWVGWIFSTVGAFGGVMAGVGHMTVFGLGGYAKSLGKNTPLNKIVTDSIK
ASNQWLVGTSGLISSFNYYRMGRLVLPLAVALGAGSIIGAWASAYFTAGKVSFSSYQGYF
GLFVLVLGLYLFWETSPAGQAHKKKAKEAAKAFEEAVKKQKSGEKIDESAIGVKVKAFTM
SRCVFTFSGVEFSFNPILPVVGGIVISAIAAFLGVGGGFLLVPFLTSISELPMYLAAGTS
ALAVLVSMITSIITLVSKGTPLDWTLIGTELVGIVIGSIIGPRTSKYFSDTLLKRIFIVL
ALYVGIDYVLRGFFNYRIFG