Protein Info for SO2823.1 in Shewanella oneidensis MR-1

Annotation: hypothetical carbon starvation protein A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 71 to 76 (6 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 363 to 388 (26 residues), see Phobius details PF02554: CstA" amino acids 4 to 143 (140 residues), 121 bits, see alignment E=3.3e-39 amino acids 155 to 284 (130 residues), 63.9 bits, see alignment E=6.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2823.1)

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>SO2823.1 hypothetical carbon starvation protein A (NCBI ptt file) (Shewanella oneidensis MR-1)
MMWFLLCVGLLIGGYFIYGTFVEKVFGINEKRQTPAFSQTDGVDFVPMSKGKVYLIQLLN
IAGVGPIFGPILGALYGPSAMLWIVIGCIFGGAVHDYFSGMLSVRNGGQSVPNLAGKYLG
KSAKHFMNVFAIVLLLLVGVVFISAPAGLLGKLTGLDVSIFVGIIFVYYLIATVVPIDKI
IGRLYPFFGALLFFMSFGLAFAIMFSSEHTLLPNVQAGDFFKNLNPDDMPLWPALFITIA
CGAISGFHATQSPLMARCVENEKNGRFVFFGAMIGEGVIALLWCAIALSYFHGVEGLNTG
MAGNPANVVYEASTGLLGAVGGFMAILGVIILPITSGDTAFRSARLILAEFFKMPQVTLP
KRLVLAIPLFVIGGLLTQVDFGVIWRYFGVAN