Protein Info for SO3142.2 in Shewanella oneidensis MR-1

Annotation: hypothetical Na+/H+ antiporte (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 12 to 46 (35 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 23 to 96 (74 residues), 44.7 bits, see alignment E=5.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3142.2)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>SO3142.2 hypothetical Na+/H+ antiporte (NCBI ptt file) (Shewanella oneidensis MR-1)
MTDRYHISRAKLAYLLDSTAAPVCVLSPVSSWGAHIIALIGGILTAHGVADSGHLTVFIQ
MIPMNFYAIFSLLLLLCVSFMGLDIGPIREHELNAMRGNLYDETKGLPPGANADLPEADT
GKILGLFLPITDLPLCIL