Protein Info for Dshi_4044 in Dinoroseobacter shibae DFL-12

Annotation: SNARE associated Golgi protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 69 to 69 (1 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details PF09335: SNARE_assoc" amino acids 64 to 180 (117 residues), 75.5 bits, see alignment E=2.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3768)

Predicted SEED Role

"FIG00616163: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>Dshi_4044 SNARE associated Golgi protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MMMRILLIAVFLMGVVALAFPDVLGVDIRLPDRAEIDRWIEAAGLAGPMVIVALMTIAIV
ASPLPSAPIALAAGAAYGHTFGTLFVVLGAELGALAAFGLARGLGRPFVERHLGQKINTG
LFGSQNTLTFLVFGSRLLPFLSFDMISYAAGLSKLHLWRFALATMAGIIPASFLLAHMGN
QAMNGDARTATWTALALGGFTGLSVLFAATRKTGTQGEES