Protein Info for Dshi_4043 in Dinoroseobacter shibae DFL-12

Annotation: cation diffusion facilitator family transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 41 to 41 (1 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 287 (273 residues), 209.2 bits, see alignment E=3.9e-66 PF01545: Cation_efflux" amino acids 17 to 208 (192 residues), 116 bits, see alignment E=9.8e-38

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to dsh:Dshi_3767)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>Dshi_4043 cation diffusion facilitator family transporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MASHSHAGHMPSSGKALVISAWLTGVYFVIELAVGLWTGSIAVLSDAFHTLSAVGGVLVA
ITAQRIARRPADSTRSFGWYRAEIIGALVNGGFLLGMALLVIWMGAMRLGDPIHLATGPM
LWVAFGGLVTEVVSLALMWQSSKDDLNARGALWHIIQTFVGSLLIIVTALVIEFTGFLAI
DPILGMAFGVVLLWASVGVIKEAVHILMEGTPEGTDLDAVTADLNGQDGVLDVHHVHAWT
LTSGKHAFSAHIRHQSPAEAADLLNRAYRRLTEQHGFHMVTLQLETECLDERHARDLDIV
QIAAAKAAQEKTDVRDAHPHPSPNTEGP