Protein Info for Dshi_3968 in Dinoroseobacter shibae DFL-12

Annotation: cation efflux protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 100 to 122 (23 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 98 to 282 (185 residues), 90.1 bits, see alignment E=7.7e-30 PF01545: Cation_efflux" amino acids 101 to 280 (180 residues), 67.3 bits, see alignment E=8e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3968)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTY8 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Dshi_3968 cation efflux protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSQPDNSKLATASSPIRMRVQGMDCAKDAAEIERAARSAGVAEGDVKVSAATHIMTLRIA
DGDLPKVRPALDATGYGFEKIEDGDTSSDPAYKDPSYRRALWIVVALNLGYGVVEMFGGF
LSGSQALKADALDFLGDGAITFLGLLAIGWSLTWRARSAMIQGVFLGLLGLGVVGSTLWR
VLNQTTPEAGLMGAFAVGALIVNILAVLPLLKHRKGDANMRAVWLFSRNDAIGNLAVVIA
AGLVAWLGSAWPDLIVAFAIAGLFLHSSWMIIRDARSDLVEAD