Protein Info for Dshi_3835 in Dinoroseobacter shibae DFL-12

Annotation: RNA polymerase, sigma-24 subunit, ECF subfamily (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 160 (149 residues), 89.4 bits, see alignment E=1e-29 PF04542: Sigma70_r2" amino acids 15 to 79 (65 residues), 61.3 bits, see alignment E=1.3e-20 PF07638: Sigma70_ECF" amino acids 80 to 159 (80 residues), 25.2 bits, see alignment E=2.8e-09 PF08281: Sigma70_r4_2" amino acids 105 to 157 (53 residues), 55.1 bits, see alignment E=9.2e-19 PF04545: Sigma70_r4" amino acids 110 to 157 (48 residues), 31.1 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 53% identical to ECFG_RHOPT: ECF RNA polymerase sigma factor EcfG (ecfG) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to dsh:Dshi_3835)

Predicted SEED Role

"RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTJ8 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Dshi_3835 RNA polymerase, sigma-24 subunit, ECF subfamily (RefSeq) (Dinoroseobacter shibae DFL-12)
MSGAPKADPRDEIVEHLSAMRAFAVSLTRNSATADDLVQDTLVKAWSNIDKFQAGTNMRA
WLFTILRNTYYSLRRKRKREVEDTEGEMAAGLAQKPDHDGRLQMREFGEAFAELPDEQRE
ALILVGAGGFSYEEAAEMCGVRIGTIKSRVNRARNKLTELLEMSEDDAMEMTDSVTQGIV
AGNQSAA