Protein Info for Dshi_3796 in Dinoroseobacter shibae DFL-12

Annotation: oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00005: ABC_tran" amino acids 24 to 183 (160 residues), 109.9 bits, see alignment E=2.4e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 233 to 317 (85 residues), 66.4 bits, see alignment E=9.1e-23 PF08352: oligo_HPY" amino acids 234 to 298 (65 residues), 59 bits, see alignment E=7.5e-20

Best Hits

Swiss-Prot: 46% identical to OPPD_SALTY: Oligopeptide transport ATP-binding protein OppD (oppD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to dsh:Dshi_3796)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LTF9 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Dshi_3796 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTHPLVEMTDVTVRFDGTPPVHAVNGVSFKLAPGEVLGILGESGSGKSVTLKTLLRLLPE
KKTRIGGQVRVDGQDVLALNGRALADHRGGVVSMIFQDPALALDPVYTIGQQIAESVVRH
EGLSQRDAMARALEMLELVRIPSAKRRLKAYPHEMSGGMRQRAMIALALACKPKLLLADE
PTTALDATVQIQVLLLLRELQKEMGMGVIFVTHDIGVAVEVSDRLAVMYAGSFVETGSVA
EIIRDGRHPYTKGLLAANLVGAEPGTPLEAIPGAPPALHAPPVGCAFAPRCDRAREACAS
DPLPVWTQGPDRWARCVAAVEDARPSGQVSAAK