Protein Info for Dshi_3726 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 37 to 84 (48 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 255 to 281 (27 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 39 to 303 (265 residues), 111.2 bits, see alignment E=2.6e-36

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_3726)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LT90 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Dshi_3726 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MHDRLDISMRANHIFFAALLGIVAIGVVFAAATGDVFYLRLATEALILGGLALSVDILLG
FGGLLSLGQALYFGIGAYVSALVLRDVPSFWLALGTATLASLVAGIVGGLIANRVRGVYF
ALITFGMAQVVAKIVYNTRELGASDGLIGVPVLEIPLGVATISAGDPVAFFLLTLAVLTV
LYGAVAYLLTTPFGRLVIANKANEKRVPFLGYSTWWPRMVSYVVAALVAGISGALYPMLR
GFVSPELMFFATSGNAVIMVILGGVGTLAGALYGAMILTFLKSVVGSYTEHHLIAIGLIF
ICAILFLPKGLIGLIKPRLETRLRDSELRRAPDAETSKGATS