Protein Info for Dshi_3725 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 47 to 82 (36 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 190 to 218 (29 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 280 (268 residues), 122.6 bits, see alignment E=8.7e-40

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_3725)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LT89 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Dshi_3725 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MAEYLHFVLAPQMLNGLALGVSVILVALGLTIIFGLLDVINMSHGEFYAVGAYGALALAA
FGVNYWVLMAMVPLMMIPLGIVTERYLIRRVYDGADRHVSTLLLTFGLGLIAEDVLKIIF
GPNTQRPENPLPGATDLMGIFIPTYRLFLIAISAAVILAVAFVVYRTRLGAIVRAASFDR
NMAASLGVRVGWVYSGAFAFGVALAGLAGVLLAPIYSVFPTMGRDFILIAFTVVIVGGMG
SIWGAVVAGIVLTQIQAISSLVISPVWSEPIVFGVMVLVLMFRPQGLFGRIGHA