Protein Info for Dshi_3679 in Dinoroseobacter shibae DFL-12

Annotation: Integrase catalytic region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF13384: HTH_23" amino acids 24 to 72 (49 residues), 32.8 bits, see alignment 1.2e-11 PF13518: HTH_28" amino acids 28 to 78 (51 residues), 31.3 bits, see alignment 4.3e-11 PF13565: HTH_32" amino acids 56 to 132 (77 residues), 36.6 bits, see alignment E=1.4e-12 PF00665: rve" amino acids 164 to 276 (113 residues), 52.3 bits, see alignment E=1.5e-17 PF09299: Mu-transpos_C" amino acids 364 to 422 (59 residues), 76.3 bits, see alignment 3.7e-25

Best Hits

Swiss-Prot: 44% identical to TRA3_STAAU: Transposase for transposon Tn552 from Staphylococcus aureus

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to dsh:Dshi_3875)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LT45 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Dshi_3679 Integrase catalytic region (RefSeq) (Dinoroseobacter shibae DFL-12)
MIIRRPVTDPLTDSLTALPEDRRAEALRRFNILRQHLIDEVPLTEVARVSGIPLRTLQRW
TSRYQRFGLAGLARAPRSDAGQRRLSSELVELIEGLALHKPRLSTAAIHRRIIPIVKSRD
WPVPSYATIHSIVNSLDPALVTLAHDGAAAYRDRFEMIHRHRAERPNAVWQTDHTQLDLI
ILDTNGAPVRPWLTIVLDDHSRAVAGYAVFVGAPSAIQTALALRQAIWRKDTPSWPICGL
PDVLYTDHGSDFTSKHLEQVAADLRIELVFSTVGRPQGRGKIERFFGTINTELLPELPGA
LSNGKPASPPRLSLGELEVAVKTFVTAVYNARKHSEIDVPPNEAWRGDGWLPRMPNSLEQ
LDLLLVMALKTRQVRRDGIRFQGLLYTDPTLAAYVGKTVNIRYDPRDITELRVFHRDRFL
CRAVSAHHAHHTISLKDIQQARTARRKALRNEITVKSRQITEFLPKPAPPPSREKQNPVS
PDAPRQKLVLYKTDKTP