Protein Info for Dshi_3615 in Dinoroseobacter shibae DFL-12

Annotation: zinc/iron permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details PF02535: Zip" amino acids 102 to 255 (154 residues), 97.5 bits, see alignment E=4.8e-32

Best Hits

Swiss-Prot: 49% identical to GUFA_MYXXA: Protein GufA (gufA) from Myxococcus xanthus

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 100% identity to dsh:Dshi_3953)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSY1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Dshi_3615 zinc/iron permease (RefSeq) (Dinoroseobacter shibae DFL-12)
MEPLSPIALGFLGSLAAGSLTAVGAVPVLFGRIPSRATRDLLLGFAAGVMLAASFFSLII
PALDAAEGQFDNGALPAAIVCVAILLGMGAIALMNERLPHEHFKTGREGPDAASLRRVWL
FIIAITIHNFPEGLAVGVGFGADGLSGGLPLAIGIGLQNAPEGLAVAVSLLGEGYSRLRA
WGIAALTGLVEPVGGLLGAGIISLSQPLLPWGLAFAAGAMLYVISHEIIPETHRSGHQNR
ATLGLAVGLVIMLFLDVWLG