Protein Info for Dshi_3554 in Dinoroseobacter shibae DFL-12

Annotation: adenylate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR01351: adenylate kinase" amino acids 13 to 221 (209 residues), 243.5 bits, see alignment E=9.2e-77 PF13671: AAA_33" amino acids 14 to 138 (125 residues), 27.5 bits, see alignment E=7.2e-10 PF00406: ADK" amino acids 16 to 202 (187 residues), 182.7 bits, see alignment E=9.8e-58 PF13207: AAA_17" amino acids 17 to 136 (120 residues), 87.9 bits, see alignment E=1.5e-28 PF05191: ADK_lid" amino acids 138 to 174 (37 residues), 41.8 bits, see alignment 1.5e-14

Best Hits

Swiss-Prot: 62% identical to KAD_MAGMM: Adenylate kinase (adk) from Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to dsh:Dshi_3554)

MetaCyc: 45% identical to adenylate kinase 1 (Saccharomyces cerevisiae)
Adenylate kinase. [EC: 2.7.4.3]; (Deoxy)adenylate kinase. [EC: 2.7.4.3, 2.7.4.11, 2.7.4.13]

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.11 or 2.7.4.13 or 2.7.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQ47 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Dshi_3554 adenylate kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MDGATLTQTKPVNVILLGPPGAGKGTQARMLEEKFGLIQLSTGDLLRAAVAAGTEAGREA
KAVMEAGALVSDEIVLAILKDRLAEGDVKAGVILDGFPRTTAQAEALDALLSDAGQGIDA
AIALVVDDEAMVGRISGRFTCGGCGEGYHDTFKVPAKSGTCDKCGSTDMTRRADDNADTV
RERLKAYHVQTAPLIGYYEAQGVLRKVDAMGEIGIVAEQLAGIVGSATS