Protein Info for Dshi_3554 in Dinoroseobacter shibae DFL-12

Annotation: adenylate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 13 to 221 (209 residues), 243.5 bits, E=9.2e-77
• PF00406: ADK
  • amino acids 16 to 202 (187 residues), 182.7 bits, E=7.4e-58
• PF13207: AAA_17
  • amino acids 17 to 135 (119 residues), 86.8 bits, E=2.5e-28
• PF05191: ADK_lid
  • amino acids 138 to 174 (37 residues), 42.2 bits, 9e-15

Best Hits

Swiss-Prot: 62% identical to KAD_MAGMM: Adenylate kinase (adk) from Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to dsh:Dshi_3554)

MetaCyc: 45% identical to adenylate kinase 1 (Saccharomyces cerevisiae)
Adenylate kinase. [EC: 2.7.4.3]; (Deoxy)adenylate kinase. [EC: 2.7.4.3, 2.7.4.11, 2.7.4.13]

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (7/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.11 or 2.7.4.13 or 2.7.4.3

Sequence Analysis Tools

See A8LQ47 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Dshi_3554 adenylate kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MDGATLTQTKPVNVILLGPPGAGKGTQARMLEEKFGLIQLSTGDLLRAAVAAGTEAGREA
KAVMEAGALVSDEIVLAILKDRLAEGDVKAGVILDGFPRTTAQAEALDALLSDAGQGIDA
AIALVVDDEAMVGRISGRFTCGGCGEGYHDTFKVPAKSGTCDKCGSTDMTRRADDNADTV
RERLKAYHVQTAPLIGYYEAQGVLRKVDAMGEIGIVAEQLAGIVGSATS