Protein Info for Dshi_3548 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 44 to 307 (264 residues), 123.1 bits, see alignment E=2.6e-39 PF00005: ABC_tran" amino acids 380 to 525 (146 residues), 101.9 bits, see alignment E=7e-33

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to dsh:Dshi_3548)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA (EC 3.6.3.25)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 3.6.3.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQ41 at UniProt or InterPro

Protein Sequence (601 amino acids)

>Dshi_3548 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MTAPDTQSPAPADKPRREPMFTPEDKANIAWFWRGYLREKLPWLIVVFGMVIAQGFVYQQ
FLRLTESGLRVIFDSGTLRDLVVICAAVFGVFAFRGVMSYLIPRVSVWIAADAVAKLRRE
LIHHLMELDLAFFEHTPPAAMIQKLVGQVEGLGNFVGQTTVKAGRDIATVVIVSIYLAYQ
QPLLFASAAIVFPVIILTMQLVSRKVKLVQAQTENAMRDYISTIDETMSGMRTVKIAGQE
EVEEDRLVKSTSRLRRLTIRRNAAQAVILPCIDFAAAFVYMLVIGGGGYMVISPAFDVDG
AAIIAFLIGLVLIFDPGRRIAQFVVSLQGALVQLRLVRGLYDERAGIVDAPDAVSEFDTG
ADLTLDNVTFGYEPDRPLFRDLSLTFGGGQVTAIVGPTGSGKTTILSLLGRLYDPIGGTV
RIGDIPVNKIRISDLRQAFSVVAQDIVIFNSSILDNIRYVNPDATDAEVRAAAEAAELAD
VIAERGDLPVGPKGAQLSGGQKQRIAIARAFLRDAPIILLDEATSALDQKTEDKVKRALG
RLARGKTTIMVAHRLSSVIDADRIYVLETGALVEQGTHAELLAKNGLYAQLFDSQKQSYG
N