Protein Info for Dshi_3533 in Dinoroseobacter shibae DFL-12
Annotation: 2-vinyl bacteriochlorophyllide hydratase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to BCHF_RHOCB: 2-vinyl bacteriochlorophyllide hydratase (bchF) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
KEGG orthology group: K11336, 3-vinyl bacteriochlorophyllide hydratase [EC: 4.2.1.-] (inferred from 100% identity to dsh:Dshi_3533)MetaCyc: 71% identical to chlorophyllide a hydratase (Rhodobacter capsulatus)
RXN-8785 [EC: 4.2.1.165]; 4.2.1.165 [EC: 4.2.1.165]
Predicted SEED Role
"2-vinyl bacteriochlorophyllide hydratase BchF (EC 4.2.1.-)" in subsystem Carotenoids or Chlorophyll Biosynthesis (EC 4.2.1.-)
MetaCyc Pathways
- superpathway of bacteriochlorophyll a biosynthesis (20/26 steps found)
- bacteriochlorophyll a biosynthesis (8/13 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Nucleotide sugars metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.-
Use Curated BLAST to search for 4.2.1.- or 4.2.1.165
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LQ26 at UniProt or InterPro
Protein Sequence (162 amino acids)
>Dshi_3533 2-vinyl bacteriochlorophyllide hydratase (RefSeq) (Dinoroseobacter shibae DFL-12) MSTGLNTQENRVGLYTPEQKKRRDESVWTLIQGILAPLQFLVFAISLVLVVRYMMTGEGY VLASISILIKTGFLYAIMITGAIWEKVVFGQYLLAPAFFWEDVVSFFVIALHTLYVWAFL SGTIPPQGQMLIALAAYLVYVVNAGQFLWKLRMARLQAEAMA