Protein Info for Dshi_3533 in Dinoroseobacter shibae DFL-12

Annotation: 2-vinyl bacteriochlorophyllide hydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 28 to 54 (27 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details TIGR02020: 2-vinyl bacteriochlorophyllide hydratase" amino acids 14 to 155 (142 residues), 186.7 bits, see alignment E=1.2e-59 PF07284: BCHF" amino acids 15 to 153 (139 residues), 210.2 bits, see alignment E=6.1e-67

Best Hits

Swiss-Prot: 71% identical to BCHF_RHOCB: 2-vinyl bacteriochlorophyllide hydratase (bchF) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K11336, 3-vinyl bacteriochlorophyllide hydratase [EC: 4.2.1.-] (inferred from 100% identity to dsh:Dshi_3533)

MetaCyc: 71% identical to chlorophyllide a hydratase (Rhodobacter capsulatus)
RXN-8785 [EC: 4.2.1.165]; 4.2.1.165 [EC: 4.2.1.165]

Predicted SEED Role

"2-vinyl bacteriochlorophyllide hydratase BchF (EC 4.2.1.-)" in subsystem Carotenoids or Chlorophyll Biosynthesis (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.165

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQ26 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Dshi_3533 2-vinyl bacteriochlorophyllide hydratase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSTGLNTQENRVGLYTPEQKKRRDESVWTLIQGILAPLQFLVFAISLVLVVRYMMTGEGY
VLASISILIKTGFLYAIMITGAIWEKVVFGQYLLAPAFFWEDVVSFFVIALHTLYVWAFL
SGTIPPQGQMLIALAAYLVYVVNAGQFLWKLRMARLQAEAMA