Protein Info for Dshi_3522 in Dinoroseobacter shibae DFL-12

Annotation: antenna complex alpha/beta subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 53 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details PF00556: LHC" amino acids 5 to 44 (40 residues), 56.4 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 82% identical to LHA1_RHOS4: Light-harvesting protein B-875 alpha chain (pufA) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K08926, light-harvesting complex 1 alpha chain (inferred from 100% identity to dsh:Dshi_3522)

Predicted SEED Role

"Light-harvesting LHI, alpha subunit" in subsystem Bacterial light-harvesting proteins or Photosystem II-type photosynthetic reaction center

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQ15 at UniProt or InterPro

Protein Sequence (53 amino acids)

>Dshi_3522 antenna complex alpha/beta subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MSKFYKIWLIFDPRRVFVAQGVFLFLLAAMIHLVLLSTEHFNWFELAAANAAM