Protein Info for Dshi_3452 in Dinoroseobacter shibae DFL-12
Annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to Y2845_RHOS4: UPF0093 membrane protein RHOS4_28450 (RHOS4_28450) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
KEGG orthology group: K08973, putative membrane protein (inferred from 100% identity to dsh:Dshi_3452)Predicted SEED Role
"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Biosynthesis of alkaloids derived from shikimate pathway
- Limonene and pinene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.3.-.-
Use Curated BLAST to search for 1.3.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LPC0 at UniProt or InterPro
Protein Sequence (145 amino acids)
>Dshi_3452 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12) MDLYVWIKSLHVISVIAWMAGLFYLPRLFVYHVESNAVSGETEALFQTMERRLLRAIMNP AMISSWIFGLWLVMTPGIVDWSAFWPYTKLAAILGMTWFHMWCAGQRKELLAGTSTTTGR RYRMMNEVPTLLLLVIVFSVIARPF