Protein Info for Dshi_3446 in Dinoroseobacter shibae DFL-12

Annotation: FxsA cytoplasmic membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details PF04186: FxsA" amino acids 6 to 112 (107 residues), 124.6 bits, see alignment E=1e-40

Best Hits

KEGG orthology group: K07113, UPF0716 protein FxsA (inferred from 100% identity to dsh:Dshi_3446)

Predicted SEED Role

"FxsA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPB4 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Dshi_3446 FxsA cytoplasmic membrane protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MWLFALFVAVPLIEIALFIQVGGWIGLWPTLAIVVVTALLGTALVRSQGLRAMADLRGSF
ADLRDPTEALAHGAMILFSGALLLTPGFFTDAVGFSLLMPPVRLAIIRYVRARIKVQQFE
MGRAPQNRRTSTADIIETEYADLDETPPRSNGPSGWTKDPTRD