Protein Info for Dshi_3444 in Dinoroseobacter shibae DFL-12

Annotation: MltA domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03562: MltA" amino acids 92 to 235 (144 residues), 173.8 bits, see alignment E=2.9e-55 PF06725: 3D" amino acids 258 to 328 (71 residues), 85 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 100% identity to dsh:Dshi_3444)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPB2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Dshi_3444 MltA domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MIPLRAAVLGVGLMAGATPAHASVELLGFGDLKGWAEDSHTEALEAFRTTCVDLKDPAWG
PICAIARATNDARGFFESLFLPILIKGDDEALFTGYYEPELRASRTRGGAYQYPIYQVPP
ELPRDRPWYTRGELEDRGILNGRGLELAYATDPVEVFFLQVQGSGRLRLTDGTVMRVGFA
AKNGHDYSSVGREMVRRGLYQPHQVSADRIKAWVRANGAAGKRLLHHNKSFVFFREVSTV
PAHLGPLGAMNRSITPMRTIAVDPTYTPLGAPVWIEKGGADPLRRLMVAQDTGSAIKGAQ
RADVFYGSGEAAGDKAGRIRDPGRMVVLLPVELALSYVESGM