Protein Info for Dshi_3416 in Dinoroseobacter shibae DFL-12

Annotation: Uroporphyrinogen III synthase HEM4 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF02602: HEM4" amino acids 30 to 218 (189 residues), 74.4 bits, see alignment E=3.8e-25

Best Hits

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 100% identity to dsh:Dshi_3416)

Predicted SEED Role

"Uroporphyrinogen-III synthase (EC 4.2.1.75)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP84 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Dshi_3416 Uroporphyrinogen III synthase HEM4 (RefSeq) (Dinoroseobacter shibae DFL-12)
MVTQPPLPVLLTRPRAQSEQFAATLPPVLRPVISPLLHILHLDDLPPAPETATLIFTSGN
GVTAYATQHPGIGQSALCVGTKTTAIARDLGFDAISAEGDARAILDLAAAYPGPFVHVRG
KHTTGDIAGALRDLGKEVAEIIAYDQTPVELSETARAILEGPCAVPLFSPRTACLFTNAC
PTARTAQIIAMSPAVAEQLPEHAYSGISILEKPNAAAMRDALLAYAGGNHLEAGRTSG