Protein Info for Dshi_3345 in Dinoroseobacter shibae DFL-12

Annotation: nicotinate phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 18 to 416 (399 residues), 294.9 bits, E=5.1e-92
• PF17767: NAPRTase_N
  • amino acids 23 to 146 (124 residues), 85.1 bits, E=4.9e-28
• PF04095: NAPRTase
  • amino acids 188 to 421 (234 residues), 157.2 bits, E=6e-50

Best Hits

Swiss-Prot: 60% identical to PNCB_AGRVS: Nicotinate phosphoribosyltransferase (pncB) from Agrobacterium vitis (strain S4 / ATCC BAA-846)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to dsh:Dshi_3345)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

See A8LNI4 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Dshi_3345 nicotinate phosphoribosyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MVDIAERVYNHNWKIDPIVRSLIDTDFYKLLMCQSVFRNRPDTRVTFSLINRSTDIRLAE
LIDEGELREQLDHIRSLSLSRGESTWLRGNMFYGKRQMFRSDFMEWFEGMRLPPYTLTKR
DGQYELTFEGQWHEVMLWEIPALAILMELRSRAVLRDMGKFELQVLYARAMTRLWEKVER
LRDIPDLRLADFGTRRRHSFMWQDRCVQAMIEGLAQKFVGTSNCLIAMRREVEAIGTNAH
ELPMVYSALADSDAELRKAPYQVLADWHEEHEGNLRIILPDTYGTEGFLAEAPDWLTGWT
GIRIDSGDPATGAERAIAWWRSRGEDPREKLIIFSDGLDVDKIAELQVQFSGRVRVSFGW
GTLLTNDFRGLVEGDGLAPFSLVCKAVSANGRPTVKLSDNPNKAMGPADEVARYKRVFGL
GAQVPQEVIV