Protein Info for Dshi_3316 in Dinoroseobacter shibae DFL-12

Annotation: phosphoserine phosphatase SerB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00338: phosphoserine phosphatase SerB" amino acids 74 to 279 (206 residues), 202.6 bits, see alignment E=5.9e-64 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 80 to 248 (169 residues), 103.4 bits, see alignment E=1.4e-33 PF12710: HAD" amino acids 80 to 247 (168 residues), 88 bits, see alignment E=1.7e-28 PF00702: Hydrolase" amino acids 82 to 251 (170 residues), 58.3 bits, see alignment E=2.1e-19 PF08282: Hydrolase_3" amino acids 214 to 257 (44 residues), 38.5 bits, see alignment 1.7e-13

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to dsh:Dshi_3316)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNF5 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Dshi_3316 phosphoserine phosphatase SerB (RefSeq) (Dinoroseobacter shibae DFL-12)
MFVATLLTDPAAPALEEAMVTALRDAWGGGDARWLAAGEAAEFPLQEVPGNLWQVWADLQ
GQRVDLVVQPAAGRRKAMLLADMDSTMIRQECIDELADEAGVGPRVAEITARAMNGELDF
EGALRERVGLLAGLDAAVIDRVLETRIDLMPGGRALVATMKRDGAYAALVSGGFTAFTAR
VAALLGFDENRANTLEIVDGVLTGRVIEPILGRAAKVAALEEITARLGISEADVMAVGDG
ANDLGMLGRAGAGVALHAKPVVAAECDRRINFGDLSALLFLQGYSRADFATT