Protein Info for Dshi_3301 in Dinoroseobacter shibae DFL-12

Annotation: branched-chain amino acid aminotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR01122: branched-chain amino acid aminotransferase" amino acids 13 to 288 (276 residues), 267.3 bits, see alignment E=7.9e-84 PF01063: Aminotran_4" amino acids 38 to 265 (228 residues), 153.2 bits, see alignment E=5.3e-49

Best Hits

Swiss-Prot: 42% identical to ILVE_METTH: Putative branched-chain-amino-acid aminotransferase (ilvE) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K00826, branched-chain amino acid aminotransferase [EC: 2.6.1.42] (inferred from 100% identity to dsh:Dshi_3301)

MetaCyc: 42% identical to branched-chain-amino-acid aminotransferase subunit (Methanothermobacter thermautotrophicus)
Branched-chain-amino-acid transaminase. [EC: 2.6.1.42]

Predicted SEED Role

"Branched-chain amino acid aminotransferase (EC 2.6.1.42)" in subsystem Alanine biosynthesis or Branched-Chain Amino Acid Biosynthesis or Isoleucine degradation or Leucine Biosynthesis or Leucine Degradation and HMG-CoA Metabolism or Pyruvate Alanine Serine Interconversions or Valine degradation (EC 2.6.1.42)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.42

Use Curated BLAST to search for 2.6.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMV9 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Dshi_3301 branched-chain amino acid aminotransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MVGAYDDRDGTIWMDGKLVDWRAANVHILTHAMHYASSVFEGERAYNGKIFESRRHSERL
HFSAGELDIEIPFTVDEIEAAKYEVMKVNGLSDAYVRAVAWRGAGPDMGVASARNPVHLA
IACWEWGSYYGDAKTRGAKLDIAKWKRPSPETIPVHAKAAGLYMICTTSKHAAEAKGCSD
ALFMDYRGYVAEATGANIFFVKDGEVHTPDPDCFLNGITRQTVIGMLRDKQVKVHERHIM
PEELEGFEQCWLTGTAAEVTPVGQIGTYNFEVGALTRDIAESYEQLVRA