Protein Info for Dshi_3260 in Dinoroseobacter shibae DFL-12

Annotation: chemotaxis protein MotA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 282 (282 residues), 358.7 bits, see alignment E=9.8e-112 PF20560: MotA_N" amino acids 4 to 94 (91 residues), 122.8 bits, see alignment E=5.5e-40 PF01618: MotA_ExbB" amino acids 134 to 234 (101 residues), 54.5 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 37% identical to MOTA_ECOLI: Motility protein A (motA) from Escherichia coli (strain K12)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to dsh:Dshi_3260)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMR8 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Dshi_3260 chemotaxis protein MotA (RefSeq) (Dinoroseobacter shibae DFL-12)
MIGIIGIVVVFVMVFGGYLAAGGKMGIILKSLPFEMTMIGGAAVGAFVIGNDMSGIKHTL
KDVKKVFKGPTWLAQDYKDLLCLLFELIRLARQNPVGLEEHIEDPAASNIFSKYPKIMAD
REAIDLIADTMRSAAMNYDDPHQVEEVLEKRIESNHEHAMHGSHALQTVADGLPALGIVA
AVLGVIKTMGSIDQPPEILGKLIGGALVGTFLGVFLAYGLVGPFSAKVKSVVEEDAHFYL
LIREVLVANLHKHTVNNCIEVGRQNTPSHIRPTFSDLEEALKQLKQEAA