Protein Info for Dshi_3257 in Dinoroseobacter shibae DFL-12

Annotation: type III secretion system inner membrane R protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 72 to 114 (43 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details amino acids 240 to 242 (3 residues), see Phobius details PF01311: Bac_export_1" amino acids 14 to 246 (233 residues), 153.7 bits, see alignment E=3.2e-49

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to dsh:Dshi_3257)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMR5 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dshi_3257 type III secretion system inner membrane R protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTWTLAEIAGDVFPVFILALLRIGAAMAFLPAFGERAVPLRIKLVLTLALTALVLPTLLA
TGAPPLERPADWVLAGGAEVVSGLFLGFTFRLMVFALQVAGTIAAQSTSLAQVFGGAVTP
DPQPALGNIFLMAGLALAALSGLHVHLTEAFLLSFLLLPVGNFPNSDIISAWAIADVSRM
FVVGFTLSAPFVAAAMLYNLALGAINRAMPQLMVAFVGAPALTLGGLALAALSVPFLLTH
WWYLFEASIFAPFGPVR