Protein Info for Dshi_3256 in Dinoroseobacter shibae DFL-12

Annotation: type III secretion exporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 185 to 214 (30 residues), see Phobius details PF01312: Bac_export_2" amino acids 9 to 349 (341 residues), 334.1 bits, see alignment E=5e-104

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to dsh:Dshi_3256)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMR4 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Dshi_3256 type III secretion exporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MSEDESPDDKPFEASEKKLLDARKKGELVKSTDLIATGSYGGLILGLVFAGAGTLTISAA
TMQGLLREADTLAPELFAGGASSISLTLILGTVGALSLWFFLPMLGAIASLVLQRALVFA
PTKLEPKLNRISILSNAKNKFGREGLFEFLKSTFKLVVFSILLGLLFMYELDTMISLAAQ
PVSAIIGFVFYLLIEFLALVFLATLLIGGVDYIWQRAQHLRKNRMSRQEVVDETKSAEGD
PHSKQYRRQRAIEIATQQMLADVPDASVVVVNPTHYAVALKWDRFSPTAPIVVASGVDHV
AAAIRQRAQEAGVPIHRDPPTARALYATCKLGQEIPRAQFKAVAAAIRFAEAMRAKARKK
PL