Protein Info for Dshi_3241 in Dinoroseobacter shibae DFL-12

Annotation: glycosyl transferase group 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF20706: GT4-conflict" amino acids 100 to 277 (178 residues), 39.3 bits, see alignment E=8.2e-14 PF00534: Glycos_transf_1" amino acids 152 to 315 (164 residues), 107.8 bits, see alignment E=9.2e-35 PF13692: Glyco_trans_1_4" amino acids 167 to 311 (145 residues), 102.7 bits, see alignment E=4.4e-33 PF13524: Glyco_trans_1_2" amino acids 215 to 339 (125 residues), 28.7 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 55% identical to LPSB_RHIME: Lipopolysaccharide core biosynthesis mannosyltransferase LpsB (lpsB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K12989, mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to dsh:Dshi_3241)

Predicted SEED Role

"Glycosyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMP9 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Dshi_3241 glycosyl transferase group 1 (RefSeq) (Dinoroseobacter shibae DFL-12)
MSTRPSPRDLDVIAPNLKQRLSGVTSTIIRLVPLQARQIAIAATGPGLPDHVPHIPLSAL
VTLPRDRWRVWHARRNTEMLLGLVLRHVFRRKLRLLFTTASQRQHSAYTKWLIRQMDGVV
AVSRKSAAYLDRPATVILHGIDLDDFTPPADKPALRARLGLDPKATLIGCIGRIRAQKGT
DLFVDAMLRLLPDRPGAQAIVLGRATEAHKEFLAGLQSRIAAAGLSDRIHFPDEVPPDQV
AAWYQALDLYVAPQRWEGFGLTPLEAMACAVPVVAADVGAFSEQLDPPEIGLLVPHDDLA
ALTAATDEMLDRDLAAEGAKARAKMEAEFSLSREAEALIAVYRDLLSRP