Protein Info for Dshi_3212 in Dinoroseobacter shibae DFL-12

Annotation: oxidoreductase molybdopterin binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR04555: sulfite dehydrogenase" amino acids 17 to 421 (405 residues), 614.1 bits, see alignment E=6.1e-189 PF00174: Oxidored_molyb" amino acids 110 to 270 (161 residues), 169.3 bits, see alignment E=5.8e-54 PF03404: Mo-co_dimer" amino acids 292 to 398 (107 residues), 60.7 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3212)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM36 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Dshi_3212 oxidoreductase molybdopterin binding (RefSeq) (Dinoroseobacter shibae DFL-12)
MDQPEKSSSRLLASSGRRAFLGASAGLGAAAVAGLAARAAPLAVPESNRTMGDPIPETDY
GMPIEYEDHVRRRRTDVFVNRQNYSDWSMTPLHQQLGIATPNGLFFERHHNGVARIDPDV
HRVAIHGMVRQPLLFSMDDLMRYPSVSRFHFLECSGNGLTDWREARSTTVQQSHGLLSCA
QWTGIPLSWLLDEAGLQDGASWVVLEGADGSGHLRSIPIDKIMDDALLAYGQNGEMLRAE
QGYPVRAILPGWEGNTNVKWLRRIYVTNEPLHVRGETARYTDPMPDGKWRQFSMEMEAKS
VITNPSGGMRLPGPGPVELSGFAWSGNGTISHVDVTVDGGRSWVEAQLEGPVMEKCLTRF
RFRWNWDGTPAKIASRAVDSTGYVQPTAEQLARVREISGFVQHNNAIFPWTIASNGEVGN
AIA