Protein Info for Dshi_3195 in Dinoroseobacter shibae DFL-12

Annotation: periplasmic copper-binding (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR04247: nitrous oxide reductase family maturation protein NosD" amino acids 32 to 408 (377 residues), 481.4 bits, see alignment E=1.4e-148 PF05048: NosD" amino acids 146 to 342 (197 residues), 177.4 bits, see alignment E=2.7e-56 PF13229: Beta_helix" amino acids 159 to 279 (121 residues), 49.6 bits, see alignment E=3.6e-17 amino acids 231 to 326 (96 residues), 29.9 bits, see alignment E=4.2e-11 TIGR03804: parallel beta-helix repeat" amino acids 162 to 201 (40 residues), 27.8 bits, see alignment 1.6e-10

Best Hits

KEGG orthology group: K07218, nitrous oxidase accessory protein (inferred from 100% identity to dsh:Dshi_3195)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosD" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM19 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Dshi_3195 periplasmic copper-binding (RefSeq) (Dinoroseobacter shibae DFL-12)
MVRLLVLAVLLTLSLPLAAAERRLAPGAPGDLQTAIAGASPGDVLILAPGRYPGALRIDV
PVTLTAEGGEAIIDGLGQGTAVEIAAEDVTIRGLTVTGSGMSSKDLDAGIKILRKAHRAV
ITHNRVLGNLHGIDIHGGHDALVAHNEIVGTLQPRLNDRGNGIYVWNSPGAVVEGNSVRY
GRDGIFANTSKKNVFRNNIFRDLRFAVHYMHTHNSEVIGNVSIGNRLGYAIMYSNRVVVR
DNLSLGDRNHGVMLNFSNNTDVANNLVRGGSEKCLFIYNAHKNLIYDNRFEGCDIGIHFT
AGSERNVLTGNAFIGNREQVRYVGTKTVEWSHEGAGNYWSDHPAYDLNGDGAADNVFRPN
DLMDHILWSQPAAALLLGAPAVQLVRWSQSSFPATLPGGVVDSHPAMTPVTIPVPDALLA
LEAAAAGRWDEGDQDDFDPENFNAH