Protein Info for Dshi_3193 in Dinoroseobacter shibae DFL-12

Annotation: FMN-binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 427 to 443 (17 residues), see Phobius details amino acids 455 to 473 (19 residues), see Phobius details amino acids 493 to 518 (26 residues), see Phobius details amino acids 562 to 581 (20 residues), see Phobius details amino acids 601 to 618 (18 residues), see Phobius details PF04205: FMN_bind" amino acids 78 to 158 (81 residues), 27.1 bits, see alignment E=5.5e-10 PF12801: Fer4_5" amino acids 501 to 543 (43 residues), 52 bits, see alignment 5.4e-18 amino acids 602 to 640 (39 residues), 25.5 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3193)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosR" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM17 at UniProt or InterPro

Protein Sequence (728 amino acids)

>Dshi_3193 FMN-binding domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTPLRWIAHFLLLLTLAMPAWADPVLPRYLAKTPAADLVPGAEGYGPIREDVPVAPILKD
GEVAAWAFITSDFVSTTGYSGKPIDVLVAVAPDATVSAVRLVKHSEPIVLIGIPESEMRT
LIEAYAGLDLVAEAESGGTAHELDIISGATVTVMVIDDSIVRSGLRVARALGLGGLAPPP
PDTGPAFELDLDAPAAPDWMTLEGDGTLRRLSLDVGQINAAFATMGDPRAAERALTLPPE
TTFIEMQTALVSHPAIAASLLGEATARNVADWLEPGDHAIAVFGRGLYSFKGSGYVRGGI
FDRIVLIQDEISVRFRDRMHKRIVSVEAEGAPVFVEADLFKIPADSGFDPAEPFRIQLLV
QREVGPIEKVFTTFDLGYQLPAGYLRAVTPPAAPAPSNAVNDLLAQDEAAAQQALWKRIW
ADKTVEIAVTGGLLGLLTLVFFFQGMATRNARAFFWFRMTFLSVVLVYLGWYANAQLSVV
NLMALFGALTTDFSWQAFLLDPLTFILWFAVAAALLFWGRGAYCGWLCPFGALQELTNKI
ARACRIPQWELPWGLHERLWPVKYMIFLGLFGVSLASLEQAEHLAEVEPFKTAIILNFQR
AWPFVAYALALLAAGLFVERFFCRYLCPLGAALAIPARLRMFDWLKRYRECGNPCQSCAN
QCPVQAIHPTGEINPNECVNCLHCQVLYQSETTCPVVIKKLKRRQTVGSVTPRDLTGHPN
VKTPQPAE