Protein Info for Dshi_3182 in Dinoroseobacter shibae DFL-12

Annotation: NnrS family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 362 to 389 (28 residues), see Phobius details PF05940: NnrS" amino acids 8 to 390 (383 residues), 329.5 bits, see alignment E=1.8e-102

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to dsh:Dshi_3182)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM06 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Dshi_3182 NnrS family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MKQSLHRLFGDGFRIFFLAAGVFGLLAAIYWQAWLGVHAFGGMVTEHSFAPPPHLWHAHE
MIFGYAGAALGGFFLTAVPNWTGAKAARHGFIVLVAGLWLAGRVAIWMSGSLPPVLVAAV
DLAFLPVLATKILTQLLNRPKPQNMMFLGLLTLVWLANATVHADWIGLGGPGAEVGLRAG
LLGICAMIAVLGGRVTPAFTRNAMTRAGRETDLPASRKPVELIGIALAIGLPVLVLAEAP
ERLIAVLAVICGAAQLARLAGWRTGWTLGQPILWSLHLAFGMLGAGYLLLGLSLTGMGSE
VAALHVLGIGTVGGMTVAVMSRAILGHSGRALVAPRPVALAFGLIGLAAVIRWVGSSAQI
DLYFAAMLVAGALWIAAMALFVLSLLPAILGSSAAE