Protein Info for Dshi_3159 in Dinoroseobacter shibae DFL-12

Annotation: TRAP dicarboxylate transporter, DctM subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 98 to 125 (28 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details amino acids 346 to 371 (26 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details PF06808: DctM" amino acids 10 to 422 (413 residues), 279.3 bits, see alignment E=2.6e-87 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 427 (409 residues), 310.1 bits, see alignment E=1.1e-96

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3159)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLY3 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Dshi_3159 TRAP dicarboxylate transporter, DctM subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MAGFWSVFLGGLLAFAGSGLALGAALGLTGLLILHFVANGATFVAVDAVWNVLNSFTLSA
IPLFIILGEIMLRSGVSARIYSALSPVFMRVPGGLLHTNVAVCTLFGAVSGSSLSTAAAV
GSVAYPEMTRRGYDRRTVVGSLAGGGTLGLLIPPSLSLLIFGALTETSIGQLFLAGLVPG
LLFAAMFMVYIYLRCRITPSLAPAEAARPPGREILRGVLGLWPFLLLILSIMGSITLGFA
TPTEAAGIGVIATIIIGRLWGTLTLRALAEAVYAAIRLYGAIAFVVIGATILAQAVSLLG
VPQAILETVRASDLGPLAVLAVVVLVYLVLGCFFDGLSLMIMTLPIVFPLLTGLGYDAIW
LGVIITILIEIGQVTPPVGLNLSVLVSVTKNAVSLGEAAKATVPYWLILLAGVAILTALP
ALALFLPGALM