Protein Info for Dshi_3132 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 130 (17 residues), see Phobius details PF09928: DUF2160" amino acids 43 to 132 (90 residues), 100.6 bits, see alignment E=2.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_3132)

Predicted SEED Role

"Glycerol-3-phosphate transport-related protein GlpU"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLV6 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Dshi_3132 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MRVLLPLLLTPGMAAAQQAGWGNVGQPEETGFSWTDPLWPDFWMAWTPATLAVFIGIFSA
IAVIGLMEGFKYKDGLERKGVLGLTTTLGDRLFITLLGSVYIFLAWLGFIGQPIWTPLAL
AIAWGIFTFWKV