Protein Info for Dshi_3105 in Dinoroseobacter shibae DFL-12

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 27 (5 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 178 to 205 (28 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 3 to 151 (149 residues), 110.3 bits, see alignment E=5.9e-36 TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 4 to 213 (210 residues), 126 bits, see alignment E=1.2e-40

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to dsh:Dshi_3105)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LL89 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Dshi_3105 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRWTIPNLMTVARLLAAPAVAIVFALLPRPLADWVALALFIGASLTDFLDGWIARTWAQT
SRFGAMLDPIADKAMVITALAVVMALSGLDPLVIIPAAIILFREVFVSGLREFLGADASK
LSVTKLAKWKTTAQMVAIAVLMGAIALDYMHLAAFAALPRDAYQAALDNGPQDWNLVWAT
MSVGGPAGVLGMGLLWIAALLTLITGADYFRKSLPFLSEKP