Protein Info for Dshi_3067 in Dinoroseobacter shibae DFL-12

Annotation: acetoacetyl-CoA reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01829: acetoacetyl-CoA reductase
  • amino acids 3 to 239 (237 residues), 348.3 bits, E=1.2e-108
• PF00106: adh_short
  • amino acids 3 to 191 (189 residues), 180.8 bits, E=3.2e-57
• PF08659: KR
  • amino acids 5 to 168 (164 residues), 62.8 bits, E=6.1e-21
• PF13561: adh_short_C2
  • amino acids 12 to 235 (224 residues), 193 bits, E=9.6e-61

Best Hits

Swiss-Prot: 73% identical to PHAB_RHIME: Acetoacetyl-CoA reductase (phaB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 100% identity to dsh:Dshi_3067)

MetaCyc: 78% identical to (R)-3-hydroxybutyryl-CoA dehydrogenase (Cereibacter sphaeroides)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36) of ethylmalonyl-CoA pathway" (EC 1.1.1.36)

MetaCyc Pathways

• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• ethylmalonyl-CoA pathway (8/11 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• 4-oxopentanoate degradation (3/9 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

See A8LL51 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Dshi_3067 acetoacetyl-CoA reductase (RefSeq) (Dinoroseobacter shibae DFL-12)
MGRVALVTGGSRGIGEAISKKLKADGYTVAATYAGNDEKAAAFTEATGIKTYKWNVADYE
SSKAGIAQVEADLGPIEVVVANAGITRDAPFHKMTPEQWHEVIDTNLTGVFNTIHPVWPG
MRERKFGRIIVISSINGQKGQFAQVNYAATKAGDLGIVKSLAQEGARAGITANAVCPGYI
ATEMVMAIPEKVRESIIAGIPVGRLGEPEEIARCVAFLASDDAGFISGSTISANGAQFFV