Protein Info for Dshi_2955 in Dinoroseobacter shibae DFL-12

Annotation: histidyl-tRNA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR00442: histidine--tRNA ligase" amino acids 13 to 462 (450 residues), 376.2 bits, see alignment E=1e-116 PF13393: tRNA-synt_His" amino acids 17 to 368 (352 residues), 118.7 bits, see alignment E=3.1e-38 PF03129: HGTP_anticodon" amino acids 397 to 489 (93 residues), 35.4 bits, see alignment E=9.9e-13

Best Hits

Swiss-Prot: 100% identical to SYH_DINSH: Histidine--tRNA ligase (hisS) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to dsh:Dshi_2955)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKA5 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Dshi_2955 histidyl-tRNA synthetase (RefSeq) (Dinoroseobacter shibae DFL-12)
MAKPKKTPRPKAQTPKGFRDYFGTEVTERKAMLDKIAEVYHLYGFDPLETSAVETVEALG
KFLPDVDRPNEGVFAWQEDDADWLALRYDLTAPLARVAAQYRNDLPSPYRRYAMGPVWRN
EKPGPGRFRQFYQCDADTVGAPSVAADAEVCAMLATALEAVGIARGDYIVRVNNRKVLNG
VFESAGLLDSEYLADNLKRVGIAIRAVDKFDRLGSDGVKALLGKGREDESGAFVEGANLA
EWQIDRILGFATAKQSTELETLDRLTELVGNSDEGLQGVEELKHISDLLSAQGFGPDRIV
IDPSVVRGLGYYTGPVFEAELTFEVQNDKGQTVQFGSVAGGGRYDDLVKRFTGQAVPATG
VSIGVDRLLAALRAKGQAQTAAPGPVIVTVMDRDRIADYQAMVGTLRDAGIRAELYLGNP
KNFGNQLKYADKRAAPVAVIQGSDEAARGVVQIKDLVLGAQIAESASLDEWKSQPAQREV
PVADLVAEVQAILARGA