Protein Info for Dshi_2936 in Dinoroseobacter shibae DFL-12

Annotation: ATP synthase F1, alpha subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 TIGR00962: ATP synthase F1, alpha subunit" amino acids 3 to 512 (510 residues), 807 bits, see alignment E=3.4e-247 PF02874: ATP-synt_ab_N" amino acids 25 to 91 (67 residues), 65.7 bits, see alignment E=6.5e-22 PF00006: ATP-synt_ab" amino acids 149 to 374 (226 residues), 266.5 bits, see alignment E=2.6e-83 PF00306: ATP-synt_ab_C" amino acids 381 to 507 (127 residues), 149 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 100% identical to ATPA2_DINSH: ATP synthase subunit alpha 2 (atpA2) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 100% identity to dsh:Dshi_2936)

MetaCyc: 70% identical to ATP synthase subunit alpha, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJR6 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Dshi_2936 ATP synthase F1, alpha subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MGIQAAEISAILKEQIKNFGQEAEVAEVGRVLSVGDGIARVHGLDNVQAGEMVEFPGGIR
GMALNLEIDNVGVVIFGSDRDIKEGDIVKRTKSIVDVPVGDALLGRVVDGLGNPLDGKGP
IETTERSIADVKAPGIIPRKSVHEPMATGLKSVDAMIPIGRGQRELIIGDRQTGKTAVAL
DTILNQKAYNDAAGDDESKKLYCVYVAVGQKRSTVAQLVKKLEETGAIEYSIVVAATASD
PAPMQFLAPYAATSMAEFFRDNGRHALIIYDDLSKQAVSYRQMSLLLRRPPGREAYPGDV
FYLHSRLLERSAKLGDDHGNGSLTALPIIETQGGDVSAFIPTNVISITDGQIFLETELFY
QGIRPAVNTGLSVSRVGSSAQTNAMKSVAGPVKLELAQYREMAAFAQFGSDLDAATQQLL
NRGARLTELMKQPQYSPLTNAEIVCVIFAGTKGYLDKIPVGDVGRYEKGLLAHLRGKHKG
LLDYITKEDPKIKGEAEDKIRAALDEFAATFA