Protein Info for Dshi_2910 in Dinoroseobacter shibae DFL-12

Annotation: Hly-III family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF03006: HlyIII" amino acids 21 to 205 (185 residues), 53.8 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to dsh:Dshi_2910)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJP0 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Dshi_2910 Hly-III family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTHFHDPERPYSRAEVLSDAAVHLGALGAALAAVPVLITLGAVWQLGAGPVTGLAVYGGS
LIVMLLCSYLYNHVRCSDCVMRLRTLDQSAIFVKIAGTYTPFALISGTGFGLLTAIWSGA
ALGVVLAALRGRGSVLPCALLCLGLGWAIVVGGQTLLATLSMPVIVLMAVGGVLYSVGVP
FLLAKRMPYHNTIWHGFVVVASVLYFIAIFVHMVQTAAPVT